SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400039507 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400039507
Domain Number 1 Region: 70-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-22
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400039507
Domain Number - Region: 490-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000148
Family Protein kinases, catalytic subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400039507
Sequence length 581
Comment PGSC0003DMT400058656
Sequence
MITSLQYLLVLHFSYLGLCLSICNINSTQYLKDPATLWCPDNMFKLGFFSPGNTTNRYVA
IWYNFSETTVVWVANRDKVPLKDSFGVFKISEDGNLVVMNGMKDVIWTSNISSTSHVVTS
SVAQLRGGNLVLLDNSKNRNIIWQSYQHPSDTFLPKMKIPINSVTTGEKTGLRSWKSPLD
PSFGDFSTSITAILPQLLIWKGKNLYWRSGQWNGQVFIGIKGMHRVHTGGYNVVDDEEGT
VYLTGFVERKKPTRFVLDSSGNLVQSYWDGIERIWKFPWSAIENDCDVYGTCGPFGSCNS
LYSPICSCLRGFEPKNIDEWEKENWTSGCVRRKSLQCDQENNKTSTRDGFLKMGYMKVPD
FAEWLPPKLEDECRSQCLSNCSCLAYAFDTGIGYMSWSGYLIDIQQFQASGTTLHIRVAH
SELDHHGEIRLIATLVIVSSFVVCVGVYLIWFWMSRQRGKIWFHFKRNNHLDGKKICLGE
IISNVGLDELPIFKFEVLAMSTNQFHDNNKLGQGGFGPVYKVNLFFSSREPICSNSGSCK
CNCHVVSFTCLLFVGSISRRGGNSCQEAFDCLRTRDGRVHE
Download sequence
Identical sequences M1C322
PGSC0003DMP400039507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]