SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400041031 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400041031
Domain Number 1 Region: 162-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 259-290
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000144
Family CCCH zinc finger 0.0018
Further Details:      
 
Domain Number 3 Region: 94-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000085
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000693
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400041031
Sequence length 294
Comment PGSC0003DMT400060957
Sequence
MDFRKRTRNDVGANVNGGVKKYKPEMDSISGGVGSKSKPCTKFFSTAGCPFGESCHFLHY
VPGGYSAVTQMMKLTPAPSLRNAAAPPNSNGNAPSMKTKLCNKFNTAEGCKFGDKCNYAH
GEWEIGKHTIPSQEDPRAMGFGSMPGRFGGGRGEPAISGPAASFGTSATAKISVDASLAG
AIIGKGGVNSKQICRQTGAKLAIRDHETDANLRNIELEGTFEQISQASAMVRELINSLGP
VGGPGRTHGNSGGPAPPMNNLKTKLCENFAKGSCTFGDRCHFAHGAAELRKTGE
Download sequence
Identical sequences M1C6S2
XP_006351343.1.80749 PGSC0003DMP400041031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]