SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400046354 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400046354
Domain Number 1 Region: 203-269
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.98e-19
Family DNA-binding domain from rap30 0.0039
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000628
Family Rap30/74 interaction domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400046354
Sequence length 276
Comment PGSC0003DMT400068601
Sequence
MAEKITGTNPKTTVHGVTTNNNLDTRNADRRVWLMKCPTVVSRFFEQHQHSTSGETDLSF
NSPRPVAKVTVVVDPLIANDSTQFTMELAGTSSGNMPTHYSMDMSTDFVPMSIFSESGQG
RVSVEGKIYHKFDMKPHHENIENYGKLCRERTNKYMTKSRQIQVIDNDNAKHMRPMPGFF
ATKASGSAAEKKKVPSKGLEMKRTRRDRDEMEEIMFKLFERQSNWTLKQLVHETDQPEQF
MKDMLKLLCIYNNKGAHQGTYELKPEYKRTEDKTDS
Download sequence
Identical sequences M1CJ95
PGSC0003DMP400046353 PGSC0003DMP400046354 XP_006360617.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]