SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400051278 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400051278
Domain Number 1 Region: 67-156,188-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-28
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400051278
Domain Number - Region: 484-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000231
Family Protein kinases, catalytic subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400051278
Sequence length 536
Comment PGSC0003DMT400075695
Sequence
MTTSSRNVHHFVHLILVILHCFNTGFCTEVDSITSTLSLRDPGILSSPGGVLKLGFFSPL
NSSNRYVGIWYNFSETIVIWVANRDKPLRDSSGVVKISGDGNILVMNGEEEILWSSNVST
SQVNSIALLQDSGNFVLVDHLNNGSTIWQSFEHPSDSIVPKMRLSENTRTGERVEVKSWR
SPWDPNFGNFSLGMNSGFIPQVYIWKGSHPYWRSGQWNGQIFIGVQGMYSVSSDGFNVVN
DREGTVYLTGPGDFDFLTKFVLDWKGNLVQSYWDVNETNWKIIWSAPNNDCEVYGTCGPF
GSCNLESPICSCLKGFEPKHREEWEKGNWTSGCVRRKALQCEVRNNSGDSSKEDGFLKIG
SIKLPDFAERSSTREDQCKSQCLGYCSCIAYAYDSGTGCMSWSNNLIDIQQFQSSGKDLY
IRVAHSELDHHKDIKKIVIPVILGFLTLCVCLFLCCTWMARLRGVKRKKINLLGDRSAVH
MEELPVFSLDTLANATSQFHEDKKLGQGGFGPVYMVQFSSLSITFQISVAEIADYL
Download sequence
Identical sequences M1CVL6
PGSC0003DMP400051278 PGSC0003DMP400051279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]