SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400051282 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400051282
Domain Number 1 Region: 70-159,191-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.76e-28
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400051282
Domain Number - Region: 484-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000144
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400051282
Sequence length 537
Comment PGSC0003DMT400075700
Sequence
MSNSSSRRRNLQYFVHIILVILRFIDTGLCSEVDNITSIQSLRDPGILSSPGGVFKLGFF
SPQNSTNRYVGIWYNFSVTTVIWVANRDKPLRDSSGVVKISRDGNVVITNGEEEILWSSN
VSTSQVNSIGLLQDSGNFVLVDHRDNMSTIWQSFEHPSDSTIPRMRISENTRTGEMVEAR
SWRSPSDPNIGDFSLRMNSGVIPQVYIWKGNRPYWRTGQWNGQIFIGVQNMYAVVSDGFN
VVNDREGTVYFTGPIRDNFLRILVLDWRGNLVQSYWNVTETNWKIIWSAPSNNCEVYGTC
GPFGSCNHLESPVCSCLKGFEPKHREEWEKGNWTSGCVRRSALQCEVKNNTANSSKEDGF
LKMELMKLPDFAERSSTSEDLCRSQCLGNCSCIGYAFDSGIGCMSWSEMIDIQQFQSSGK
DLYIHVANSELVFSADHGKDIKKIVIPVIVGSLTLCVCLFLCYTMVIRRRGVKREEVALL
GNKSPVNMEELPVFSLDTIANATSQFNEDNKLGQGGFGPVYKVRVSSLSITSHNSSY
Download sequence
Identical sequences M1CVL9
PGSC0003DMP400051282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]