SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400052090 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400052090
Domain Number 1 Region: 73-200
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-21
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400052090
Domain Number - Region: 171-282
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00034
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400052090
Sequence length 431
Comment PGSC0003DMT400076879
Sequence
MTYFIKYLLVLVLVLLIFPLHILAQTIPLGRSLIANDETTPWLSQSGDFAFGFKKIQSQN
QFLLCIYYAKIKDATIVWYANGGNLVPGGSIAELNPQKGLILRDPKGKMIIWSTGRIGSN
VAYAVMNDTGNFVLVGVDSSVLWESFRYPTDTLMPTQILEINNKLVARKSESFFVPGRFY
LRMLSDGNLVLVTQSKPTNFDYDAEYYNSHTSDSGDEANSGYRLVFDEFGSVYILKRNNQ
RLVLTPPNVPSISENYHRLSLDFDGVLTHYYHPKSTGDQKWSTLWSLPDNICLAILEDVG
SGVCGFNNVCNLGENQRPYCECPKGYSLIDPNNKYGSCKPKFVPSCDEFGQGNPEELYDF
DVVTDVDWPLSDFERIYPSAEEECKKACLEDCFCAVTIYRSNSCWKKKLPLSNGRVDTSL
NVKAFLKIRKI
Download sequence
Identical sequences M1CXJ3
XP_006361291.1.80749 PGSC0003DMP400052090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]