SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384197401|ref|YP_005583145.1| from Bifidobacterium breve ACS-071-V-Sch8b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384197401|ref|YP_005583145.1|
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000392
Family Transglutaminase, two C-terminal domains 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|384197401|ref|YP_005583145.1|
Domain Number - Region: 235-256,301-340
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0183
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384197401|ref|YP_005583145.1|
Sequence length 431
Comment hypothetical protein HMPREF9228_1332 [Bifidobacterium breve ACS-071-V-Sch8b]
Sequence
MKHLTTRMLAIIVALLASLSMMLAIVSLPHLAYAVGADDGSAQGADQSVAPTPVAGPVPN
IIVTNFTYGGDSVAAGAKFDLNFTFQNMGQVAVANMVVTVDGGESFAIAGGTNTFYFDAL
WAGYSLSQTVPMQALASAKSGAQPVTVSFRYEYLDSGARSSNQSDVKIAVPISQPDRFEV
GDPVPSDQIVAGQETTVTLEYVNKGKGDIANVETTMEGEGFDATMKTQYVGNVASGATGS
IGYAFTPTASGELNATLKVSYEDSDGQSKTKEFPVKLSVADAAPMDDPSRVDSDMNQNAS
QGLPWWVWAAAAAVAVAVIVGIVLLVRRHRKKKAKSEIDEEWDDWAGGNADGKLDTQSGG
DIASGKTVGDAADSTTANNATASGGATSTFAISPSTDATPTTVIEPVNAAAEPNQIVPDD
SGQSDGSVQTV
Download sequence
Identical sequences gi|384197401|ref|YP_005583145.1| WP_014484034.1.45026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]