SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213692844|ref|YP_002323430.1| from Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213692844|ref|YP_002323430.1|
Domain Number 1 Region: 185-254
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000314
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213692844|ref|YP_002323430.1|
Sequence length 388
Comment hypothetical protein Blon_1985 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222]
Sequence
MKHLTRRTIAIIVALLSSLALTLTVVSLPRQAYAVDGADAGGAAQGSDGGATPLAGPVPN
IIITNFAYGGDSVAAGSKFNLDFTFQNKGQVAVTNMVVTVDGAEGFAIAGGTNTFYVDAL
WAGYAMTQTVPMQALASAKSGAQPVTVNFRYEYVDAGARSSSQSDVKISVPISQPDRFEI
SDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASGATGT
IGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLTVSVADAPAADQPGASDSVEGRGGD
RGLPVPAYVAIAVGVVTVITAIVLLVRRRRRKAGKNDIDEDWDDWSAGGEGAAPGDGAAD
QASPRTSAPDGTAPGGTAPAPAAPSRKG
Download sequence
Identical sequences B7GUA6
WP_012578259.1.101695 WP_012578259.1.11785 WP_012578259.1.12559 WP_012578259.1.29604 WP_012578259.1.30595 WP_012578259.1.38041 WP_012578259.1.40827 WP_012578259.1.48267 WP_012578259.1.69278 WP_012578259.1.70852 WP_012578259.1.8081 WP_012578259.1.86319 WP_012578259.1.91730 WP_012578259.1.99918 gi|213692844|ref|YP_002323430.1| gi|213692844|ref|YP_002323430.1| 391904.Blon_1985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]