SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14520749|ref|NP_126224.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14520749|ref|NP_126224.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.48e-35
Family Translational machinery components 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14520749|ref|NP_126224.1|
Sequence length 135
Comment 30S ribosomal protein S9P [Pyrococcus abyssi GE5]
Sequence
MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSV
DIDVKVQGGGFMGQAEAARIAIARALVEWTGDMNLKEKFIKYDRTMLVGDPRRTEPHKPN
RSTKGPRAKRQKSYR
Download sequence
Identical sequences Q9V195
gi|14520749|ref|NP_126224.1| WP_010867657.1.84333 272844.PAB0366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]