SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14520757|ref|NP_126232.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14520757|ref|NP_126232.1|
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-45
Family GHMP Kinase, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 184-330
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.29e-38
Family Mevalonate kinase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14520757|ref|NP_126232.1|
Sequence length 335
Comment mevalonate kinase [Pyrococcus abyssi GE5]
Sequence
MPRLVLASAPAKIILFGEHSVVYGKPAIASAIDLRTYVRAEFNDSGNIKIEAHDIKTPGL
IVSFSEDKIYFETDYGKAAEVLSYVRHAIELVLEEADKRTGVSVSITSQIPVGAGLGSSA
AVAVATIGAVSKLLDLELSKEEIAKMGHKVELLVQGASSGIDPTVSAIGGFLYYKQGEFE
HLPFVELPIVVGYTGSSGSTKELVAMVRRRYEEMPELIEPILESMGKLVDKAKEVIISKL
DEEEKFLKLGELMNINHGLLDALGVSTKKLSELVYAARTAGAIGAKLTGAGGGGCMYALA
PGKQREVATAIKIAGGTPMITRISKEGLRIEEVRE
Download sequence
Identical sequences Q9V187
WP_010867665.1.84333 272844.PAB0372 gi|14520757|ref|NP_126232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]