SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14520826|ref|NP_126301.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14520826|ref|NP_126301.1|
Domain Number 1 Region: 9-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.87e-47
Family SCOPe 0.00022
Further Details:      
 
Domain Number 2 Region: 156-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.42e-27
Family SCOPe 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14520826|ref|NP_126301.1|
Sequence length 249
Comment exosome complex exonuclease Rrp41 [Pyrococcus abyssi GE5]
Sequence
MMEKPEGLKLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPR
ELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPR
TAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEED
NYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLK
IAQEVEGSE
Download sequence
Identical sequences Q9V119
2pnz_A 2po0_A 2po1_A 2po2_A 272844.PAB0420 gi|14520826|ref|NP_126301.1| WP_010867734.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]