SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14520827|ref|NP_126302.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14520827|ref|NP_126302.1|
Domain Number 1 Region: 12-172,201-215
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-55
Family Ribonuclease PH domain 1-like 0.00000178
Further Details:      
 
Domain Number 2 Region: 187-271
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.14e-25
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14520827|ref|NP_126302.1|
Sequence length 274
Comment exosome complex RNA-binding protein Rrp42 [Pyrococcus abyssi GE5]
Sequence
MSDNEIVAGIMRDHIINLLKEGKRIDDRGFEDYRPIEIEVGVIEKAEGSALVKLGSTQVL
VGIKTSLGEPFPDTPNMGVMTTNVELVPLASPTFEPGPPDERAIELARVIDRGIRESKAL
NLEKMVIVPGKIVRVVFIDVHVLDHDGNLMDAIGIAAIAALLNARVPKVRYNEETGEVET
LDETEPLPVEKIPVPVTFAKIGNILVVDPSLDEELVMDGKITITTDETGHISAVQKSEGG
AFKLEEVMYAVETAFKKAEEIRKLILEAVEKAKQ
Download sequence
Identical sequences Q9V118
272844.PAB0421 gi|14520827|ref|NP_126302.1| WP_010867735.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]