SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14521243|ref|NP_126718.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521243|ref|NP_126718.1|
Domain Number 1 Region: 159-275
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.7e-30
Family Homoserine kinase 0.0029
Further Details:      
 
Domain Number 2 Region: 1-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-30
Family GHMP Kinase, N-terminal domain 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14521243|ref|NP_126718.1|
Sequence length 294
Comment homoserine kinase [Pyrococcus abyssi GE5]
Sequence
MKKRIYAPATIANFGPGFDVFGMAIEEPGDEVIVKESDSFEIEVEGYDVPRDENNVAVIS
AKALFKMVGEEGGVKIRLKKGVRPKSGLGSSGASSVAGALAAARVLGVDNDELIIMAALE
GEKAASGSPHGDNVIPSYYGGFNILESLNPLRVHRVDVELNVVVVLPEVEVPTKEARRIV
PEKVPLKDAIKNLAMASSLVLALKEGDIETVGRLLDDNLALPYRKKLMPWFDEVRKAGLE
AGAYGVTVSGSGPSLFAIGENLKDIGKAMKEKFEELGIRAEFWITKTGRGAKWY
Download sequence
Identical sequences Q9UZV7
gi|14521243|ref|NP_126718.1| 272844.PAB1676 WP_010868156.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]