SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14521248|ref|NP_126723.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521248|ref|NP_126723.1|
Domain Number 1 Region: 10-303,375-422
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.01e-117
Family Alkaline phosphatase 0.0000086
Further Details:      
 
Domain Number 2 Region: 438-492
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000301
Family Type I dockerin domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14521248|ref|NP_126723.1|
Sequence length 495
Comment alkaline phosphatase IV precursor [Pyrococcus abyssi GE5]
Sequence
MMKMKLARFLLIFIIFSSMFPFANASPSGVRNVIILIGDGMGFSQLQLTKLVYGHLNMED
FPYTGIELTDSLSGEVTDSAAAGTAIATGVKTYNRMISTTNVTGKLVNLTTLLEIAQMLG
KATGLVTTTRITHATPAVFASHVPDRDMEEEIARQLILHNVTVLMGGGREKFSEEVLKLA
EDYGYSIVYTREDLEKVKDGKVLGLFAEGHLPYVLDRSEEDVSLLEMTKKAIEILEKNPN
GFFLMIEGGRIDHACHANDVASIVAETKEFDDVVGYVLDYARRRGDTLVIVLADHETGGL
GIGLNYGHSVDIDSIRRIDASIEEMSKEIKSGGDIRDVIRRHTGLELTDEEVKEIEEAKN
STNKYALGNIIGEIISKKLGVGFVSHKHTGEPVPLLAYGPGAENFVGFKHHVDTAKVIAK
LMIFGDRSISFTIKGVSKIKGDVTGDYRVDERDAYATLMLLLGDLVDTELENIADMDNNG
IIDLLDVMAILQASS
Download sequence
Identical sequences Q9UZV2
gi|14521248|ref|NP_126723.1| 272844.PAB2366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]