SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14521668|ref|NP_127144.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|14521668|ref|NP_127144.1|
Domain Number - Region: 101-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0967
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14521668|ref|NP_127144.1|
Sequence length 239
Comment hypothetical protein PAB1399 [Pyrococcus abyssi GE5]
Sequence
MKRFIPLIIMLIAIISLAYYVKLPQQTELRPLGKFYLENSYFGNYSAKSPEVVTSILWDY
RGVDTLFETSVFFLAIIGSLALFSLERRERKRKSQGLTLIVRDVTKVIVAMIITVSASIA
LHGHLTPGGGFQGGSALAVAPLLIIAAYSKYVLEEHGLDKTRALVLRSIGLLGITLVALI
PLLEGGFIMQNQPIFPAEIGGQLLSGSLIYYNIFEFLAVGAGFTAVFLLLSIPEKEVRA
Download sequence
Identical sequences Q9UYN8
gi|14521668|ref|NP_127144.1| WP_010868587.1.84333 272844.PAB1399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]