SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14521870|ref|NP_127346.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521870|ref|NP_127346.1|
Domain Number 1 Region: 57-267
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.19e-55
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00016
Further Details:      
 
Domain Number 2 Region: 310-524
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.79e-50
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000955
Further Details:      
 
Domain Number 3 Region: 605-754
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.1e-49
Family AlaX-like 0.0007
Further Details:      
 
Domain Number 4 Region: 514-600
Classification Level Classification E-value
Superfamily Translation proteins 8.12e-20
Family AlaX-M N-terminal domain-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14521870|ref|NP_127346.1|
Sequence length 914
Comment alanyl-tRNA synthetase [Pyrococcus abyssi GE5]
Sequence
MEFIMKTRMFEEEGWIRKKCKVCGKPFWTLDPDRETCGDPPCDEYQFIGKPGIPKKYTLD
EMREKFLKFFEKHEVYPHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPL
VISQPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWIDETVELAFEFFTKELKM
KPEDITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPENAPEDQVVIIKGDRYV
PMETKVVDTGYGLERLVWMSQGTPTAYDAVLGYVVEPLKRMAGVEKIDERILMENSRLAG
MFDIEDMGDLKLLRKKVAEKVGISVEELEKAIRPYELIYAIADHTKALTFMLADGVIPSN
VKAGYLARLLIRKSIRHLKELGLEVPLSEIVALHIKELHKTFPEFKEMEDVILEIIDLEE
KKYSETLKRGSDLVRREIAKLKKKGMSEIPLEKLITFYESHGLTPELVKEIAEKEGIKVH
VPDNFYSIVAKEAEKEKEEKEEEVVDFELVKDLPETRTLYYEDPFMKEFEARVLRVIGDW
IVLDQTAFYPEGGGQPYDTGVLFVNGSEVKVTNVQKVGKVIVHKVENPGLFKEGMEVRGR
IDWDRRIQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLTTDWARLDISHYKRISDEELRE
IERLANRIVMEDRKVTWEWLPRTEAEQRYGFRLYQGGVVPGRVIRVVKIEDWDVQACGGT
HLPSTGLVGPIKILRTERIQDGVERIIFACGEAAIKEWQKEREILKKASQVLRVPPEKLP
ETAERFFNEWKEARKEVEKLKKELAKLLVYELEAKVQKVKEYEFIGEIVEGSMDDLREAV
ERLKKPNRIVVLVSKEGYFAISVGDNVNLNANDLAKKLTSIAGGGGGGRKDVAQGRIKDV
SKAKEAIESIVKLL
Download sequence
Identical sequences Q9UY36
gi|14521870|ref|NP_127346.1| WP_010868790.1.84333 272844.PAB1245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]