SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14521955|ref|NP_127432.1| from Pyrococcus abyssi GE5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14521955|ref|NP_127432.1|
Domain Number 1 Region: 93-237
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.09e-32
Family AlaX-like 0.0049
Further Details:      
 
Domain Number 2 Region: 3-91
Classification Level Classification E-value
Superfamily Translation proteins 2.72e-16
Family AlaX-M N-terminal domain-like 0.00063
Further Details:      
 
Weak hits

Sequence:  gi|14521955|ref|NP_127432.1|
Domain Number - Region: 244-299
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.0209
Family Protein prenylyltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14521955|ref|NP_127432.1|
Sequence length 405
Comment alanyl-tRNA synthetase related protein (fragment), partial [Pyrococcus abyssi GE5]
Sequence
MARKLYYVDPYLKTAKAKISDLTIKGDKIEVSLTETIFYPRGGGQPGDKGKIRGDGFEII
VEDTVERDGEIWHVGKLNGRTPEVGEEVELELDWEWRYGNMQMHTGQHILSAVLKKRYDL
DTSGFNIFGDYAKIEVNGELNWEMIEEAELEANKVIIDDLPVRVEEYEVLPKGVVEKLRK
YIPNIKGKIRIVRIGENFDLTPCGGTHVKSTREVGVIKVLRFYKKSKDTWRIEFTCGFRA
IKKLNEILKDYWSALDAMPNKNPPLSERVREVLESVESLEEKVDSMRKEVWKWKEESLLG
RSIEIGHYNVVTFVEKWDIKDAQAFAVDFVKNNPGTIVVLASEDYVILARNEEVEVSMKS
LLEDLIKEFGGKGGGTDNLARGKIEAEPEDVIDFVVDRLREIIGA
Download sequence
Identical sequences Q9UXV2
gi|14521955|ref|NP_127432.1| 272844.PAB1190 WP_010868875.1.84333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]