SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18312149|ref|NP_558816.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|18312149|ref|NP_558816.1|
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00235
Family Pyk2-associated protein beta ARF-GAP domain 0.078
Further Details:      
 
Domain Number - Region: 21-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0774
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18312149|ref|NP_558816.1|
Sequence length 75
Comment hypothetical protein PAE0744 [Pyrobaculum aerophilum str. IM2]
Sequence
MPVCAVCGKDVNFKNIAYIYENIFVCKDCFPQYYIKNLCKVVEKRLKGENPIACNFCAFK
RQCDSYVSRTLKALS
Download sequence
Identical sequences Q8ZYJ5
178306.PAE0744 gi|18312149|ref|NP_558816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]