SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18312201|ref|NP_558868.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18312201|ref|NP_558868.1|
Domain Number 1 Region: 68-147
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.99e-17
Family FHA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|18312201|ref|NP_558868.1|
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00493
Family PhnA zinc-binding domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18312201|ref|NP_558868.1|
Sequence length 150
Comment hypothetical protein PAE0816 [Pyrobaculum aerophilum str. IM2]
Sequence
MPWKCPICGTENRDGDVTCRVCGAYKPEATTRKITQAIKEAISALVVVEILESPIESLVG
KKFEFKVTTPGVIVTIGRAVENHVVVTDPAVSRRHLRLIVTSNGIVVEDVGSSNGTFLLE
EGKERQIKVENIGKKGLIRIGNTKLRVSLS
Download sequence
Identical sequences Q8ZYE3
gi|18312201|ref|NP_558868.1| 178306.PAE0816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]