SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18312868|ref|NP_559535.1| from Pyrobaculum aerophilum str. IM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18312868|ref|NP_559535.1|
Domain Number 1 Region: 4-219
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.87e-22
Family Methylenetetrahydrofolate reductase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18312868|ref|NP_559535.1|
Sequence length 223
Comment hypothetical protein PAE1774 [Pyrobaculum aerophilum str. IM2]
Sequence
MEIVAELTPILYREKLLARLDALTRYVEKVDIPEAPGGKPSAHSIAVGALAKQLGIEPIV
HIRLLDINMTAYKSLLGGAYLLDIKYVVVLQGDPPAEGRPVGEISTEEAVAVAKKMGFKA
GALLSLRRDYKQRLKIGADFYLALHLREAEQLADLPPVIYPYILVKTEKNFDLFERLGQT
AVSPREALELVRKLEGLAPGVVLSVPRDFQTLLGLLQEVKIRP
Download sequence
Identical sequences Q8ZWI5
178306.PAE1774 gi|18312868|ref|NP_559535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]