SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978627|ref|YP_007689093.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978627|ref|YP_007689093.1|
Domain Number 1 Region: 288-560
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.81e-28
Family Extended AAA-ATPase domain 0.033
Further Details:      
 
Domain Number 2 Region: 734-939
Classification Level Classification E-value
Superfamily TPR-like 1.67e-25
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 3 Region: 100-268
Classification Level Classification E-value
Superfamily TPR-like 4.17e-19
Family BTAD-like 0.0025
Further Details:      
 
Domain Number 4 Region: 5-79
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000624
Family PhoB-like 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|474978627|ref|YP_007689093.1|
Domain Number - Region: 555-613
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000179
Family ROK associated domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474978627|ref|YP_007689093.1|
Sequence length 968
Comment regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRTRLAVLGPIRAWRGDTELVVGSPKQRGVLALLLAQPGCPVAMHQIVDALWGEDPPASA
VNVVQRHISALRRMLEPEMPSRGTSRWLVSGAGGYRLDADPDSLDLLRFRDLRGRAAASL
RDGDQGETTDLLLEALALWHGPTASGIPEDVRRHPVFTSVDGEHLATVKEAADLALQATG
GDHRARALVPLRQTAVQYPLDEELQARLILMLAATGHQAEALEVYQCVRTQLFNELGVHP
GPQLRSAQQRVLGRAFGEAAKPRETPADAAHGRSRTPKAPPSDTPRDTMPSPAQLPPDLA
SFTGRAEELDVLRALVPDEPASTVVISAIGGMAGVGKTTLAVHWAHQIADRYPDGQLYVD
LRGFHPAGSIMSPAEAMRSFLDAFEVPAQRIPAGLEAQAALYRSLLAERRVLIVLDNARD
TEHVRPLLPGAPGCLVVVTSRHQLYGLVAGEGAHSVTLDVLSEAEALRFLSHRLGAERVV
RETVAAAEIVASCAGLPLALVVVSARAVFNPTLSLASIASELRDSGDSLQAFAGEIPAAD
ARSAFSWSYRLLSPAAARAFRLLALHPGHDCSLTAIASVAGQPPGRVRLLLAELVRAHLV
SETAPGRYSCHELLRAYGVELGRSEDAPAELGAARRRLLEHYLHSAHAADSVLAPSRERI
SLRPGTAGVTVARFDDRAGAADWLDANRSVLLAVIEESAEYDHAEYGWQLAATIESYLDR
NGRWVEQLAAQATALSAAQRSGDVRGQAHAHRALGFAHGRLERWTEADEHLDRALILFAQ
LGDEAGQGRVHRYCAFLANARGLYRKSLEHYERAGTHYRSAGRHSGEASVANEVGWTYIL
MGDYHRALLECGRSLASHQDLGDRNGEAAAWDSLGCAHLHLGDHDRALDCFGHALQIYRA
IKDRYLEADTLVHIGDTHSAAGRSTRAAAAWRTGLEILEEIGHPDAVPVRAKLKSTADSG
SAKGCERR
Download sequence
Identical sequences gi|474978627|ref|YP_007689093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]