SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978803|ref|YP_007689269.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978803|ref|YP_007689269.1|
Domain Number 1 Region: 859-920
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.67e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 
Domain Number 2 Region: 13-239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000489
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Weak hits

Sequence:  gi|474978803|ref|YP_007689269.1|
Domain Number - Region: 549-639,725-830
Classification Level Classification E-value
Superfamily TPR-like 0.000122
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474978803|ref|YP_007689269.1|
Sequence length 929
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSDLDHPAAPAAGRLIGRDRDLEFIRSHLNGSAVHGASLLLSGEAGIGKTALLDAVAAEA
RQLGTRVLRASGVQFEADIGYAGLNQLLVPLFDSFDLLDSAHRDALRVAVGIGSGPPPNR
LLTSTAALMLLRRIADDTPLLIVVDDLPWLDRATTSVLGFVARRLIGSCISFLAASRVTS
DSFFESSGLTEHRLQPLDEASSAELLHRTHPEMSLAVRRRVAAAAHGNPLALLELSAALE
AEQRTAPTAVPSVLPLSERLQTLFAARVADLPEPSRELLLIAALEGTGDLAVIEAAGTGR
AVIDDLEPAERDRLITISAPSRRLSFRHPLIGAAVVAQATAADRRRAHRALAAVLTDQPE
RRACHLGEAATGPDETVAGLLEQAALLRLARGDALGAVAALTRAAGLSPAPADESRRLAQ
AAYIGADSGGELADASRLLAGARRADPSAGESLYAAAAFALLLINKEGDIDTAHRLLVGA
IETGGHGWDASDGALVEALFTLITLCWSSGDPQKWRPLFRALDRLTPGPPDLLWVCAQTV
ADPARTGHRALEALDALLADVGENPTRVTRIGTCATYPERLADVREACQRLVEQGRAGTA
PARRHLAALLHLCTDHYRTGRWDEAVHLASEGLVLCEQHGYRFFARKFQYVQALVAGARG
DTETSTALSEEIVGWAVPRGAHGVQVLAFHTRALTALGAGDFEAAYRHATALGPPGTLPP
YLPQAMAVTMDLVEAAIRTGRPAEAAAHAAAVRESAMADLAPRLAMLVLACEALTTPGDH
AFDLFDQALRRAEPGAWPFDVARIRLFLGERLRRRRFTKEAREQLAQALRAFEKLGAAPW
VARATAELRAGGPGAAATAQPGKGALTAQEWEIATLAATGLTNKQIAERLFLSHRTIGTH
LYQIYPKLGINSRAALRDALAGLDLDDAD
Download sequence
Identical sequences H2JL85
gi|474978803|ref|YP_007689269.1| WP_014669060.1.21199 WP_014669060.1.57224 gi|386836527|ref|YP_006241585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]