SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978841|ref|YP_007689307.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978841|ref|YP_007689307.1|
Domain Number 1 Region: 953-1011
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000238
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0063
Further Details:      
 
Domain Number 2 Region: 17-94,155-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000738
Family RecA protein-like (ATPase-domain) 0.093
Further Details:      
 
Weak hits

Sequence:  gi|474978841|ref|YP_007689307.1|
Domain Number - Region: 661-801
Classification Level Classification E-value
Superfamily TPR-like 0.0036
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474978841|ref|YP_007689307.1|
Sequence length 1015
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSAHIGSYDVGSDGTGLLGRERERTMVAALLTALPRGEGRVLHLSGAPGTGKSAVVRFAA
AAAGRQGIRVLTTAWAPGERGLRHAALHRLLRSVLAGSTGLPTRERALLDAAFGGGVAAP
GTGEPTVAGTCEPAAPDMCEPVVPGTSAAAGPVSARLVPAAPAEPAAPAPAQLAAAVMRL
LTAAAEPVLLCVDDLDRLDGASRDTLCALARLCGATRVGLIVAERAAAGVRPLPDALAMT
PDALTVTLGSLPAPQARALVTRAGRAAGYAEEQLVLAVARGNPLALTELSLDGGHLGDAA
GFGMLPATSRLAEAYAEDVEGLSAPARTVLLTAALSASPVTRDILRACTSLLGSGRAARA
GLAETIARGLVAESVGDVGPAGGVGTGGAGAGAAELDEEGGEEGVGEGVGENRRLYFPEP
LVRPAVLRLESAARRLAAHHALGRCLTSRPHAAWHTAQCAAGPDEELARRLEALAAGPRP
GTAVLVALAALDRAARLSPDPERRAARLLRAAELACDHGLTDQALGHARRIDPSELGTFG
RALLLWVHDLLPGNSAVGRERIAELCEAARAVAPQDPALTQKLLHAAARRCWWQQAGPGE
RRMVLRAFEDLRSGPRDARDAAVMALTAALPLPQAEPPHSAPGPADGDGDGGGDGDGDEQ
HLAGQVAVLVSDLDRAAPLLEEAEAAVRAGGRYGRLPQLLVPRAMGQIWLGTQWHTAQAL
AEEGRMIAGRTGQPDWVARATGTLAIIAALRGQHDKALEYAAEVEEASLRLGQNRQLNLA
ALARALTASGTGRYVEAYARLRFLFADPAAPYAFEQVWGLAFLAEAALPAGEQADARTVV
EHVTALTEAGRAPLPQRILEYADAVLAPEDEAEVRYRRALRPGAGAWPLLHGMTQFGYGA
WLRRRRRVTESRTPLATAESVLRSLGAQSRAEQAASELRATGQATDGQSGADDIARVLSP
QQLTIARLAARGLTNRAIGEQLRLSPRTVASHLYQIFPKLGVSSRAQLAARIGPD
Download sequence
Identical sequences H2JLC4
gi|386836566|ref|YP_006241624.1| gi|474978841|ref|YP_007689307.1| WP_014669099.1.21199 WP_014669099.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]