SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978880|ref|YP_007689346.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978880|ref|YP_007689346.1|
Domain Number 1 Region: 906-971
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.74e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0044
Further Details:      
 
Domain Number 2 Region: 29-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000732
Family ABC transporter ATPase domain-like 0.039
Further Details:      
 
Weak hits

Sequence:  gi|474978880|ref|YP_007689346.1|
Domain Number - Region: 390-492
Classification Level Classification E-value
Superfamily TPR-like 0.00228
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474978880|ref|YP_007689346.1|
Sequence length 980
Comment putative regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MIQATDIPPTTDGAAVPVPAAVPRGHGRQREQILQRVLRLLHREEGGVLWIEGPAGAGKS
RLLAFAAEEAAPAGALVLTGGGVAGHGMPPLAPLLDALGPLPALRSREPGSARREPGTYP
EAGSPYQLMRQVEDRLRDLAHDRPLVVVLDDVQHCDEPTLLAVRGLTARLAGLPLLWVLA
ARSHHDVPAVESLRRDLLTERAVPLDVPALDPEAVRLLVRDLLGPRAAQADPYLPLCGGL
PGAVRQLCALLASRTGTPGAVRTGGDPVAGAVAARRLDQLTQHAKELVLIASALGDSLTV
RHLSRVLGCGESALLRPLGEVLAAGLMRAGQQHLAFAHPSVRDAVVATLPPPVRLSVRRR
SVDLRLADGTPPAVLAAEIAELAEPGDEHAIRVLATAARELAPHSPATAAAHLRRAMELS
RDAAPRRMRLAARLIPLLWETGEADEARALAREVVQVPPDAATHARVCLELTRMGGRFPV
AEAEAHLRRALGHRGVPQPVKDQLLSTTLLNRLLAGEAEEAGGALAGSLARARGTHPLND
LTQRTLRSMSACHRQRWTEALGHSESVPAKVAELDPAYGAALPEVVVSTVWRAALLGLAG
DGTAAAELVEGGLADAEQRGRRAYLPLWRTARARLLLDGGRLPEAARELAAAQEPAAARE
PAAAQELAAAREPAAAGAGPRASGTSAASEAAMVCARARIAFHTGDDAELEACAALAEAC
LEGQDRQSRRAGAWIAVLTALYRDEALTRHQLGVAAAHLRRGFLHATCLDAGDVVLLVAA
ALASGQRDMAAAAVEFAEERARLNPGLPLFAGAAAHARGLFARDADLLAEAAELHGAARP
LLRARALEDAGECAASTDAGTARSRFEEALRLYTGCGAQRDARRVHGRLRKLGIRPLGAA
CAAAPAVPEPEWRGLTRSELGVVRLIAHGATNREAAERLFLSPHTVNTHLRHAFEKLGVR
SRVQLARLYAREVDSAAVSA
Download sequence
Identical sequences H2JMU1
gi|474978880|ref|YP_007689346.1| gi|386836605|ref|YP_006241663.1| WP_014669138.1.21199 WP_014669138.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]