SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979122|ref|YP_007689588.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979122|ref|YP_007689588.1|
Domain Number 1 Region: 876-943
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.5e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0036
Further Details:      
 
Domain Number 2 Region: 14-74,107-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000243
Family ABC transporter ATPase domain-like 0.08
Further Details:      
 
Weak hits

Sequence:  gi|474979122|ref|YP_007689588.1|
Domain Number - Region: 708-815
Classification Level Classification E-value
Superfamily TPR-like 0.000215
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474979122|ref|YP_007689588.1|
Sequence length 948
Comment putative regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDRFLQPRMSARADGVHPRVRGRDEELAFLGARFDALAEGRGGVVCIEGPPGSGKTRLLA
EVQRMAVERRLRLFRGGADPDGQFVPLGPLLDGLSTGSGSLFDADRLRSLAAAPEQRFWL
LQELQDRLEQVALDTPLVITMDDVQWLDDVTLLALRTLSVRLSAHAILWVVSVRSTVVAP
GVRTMIDHLESIGGHRLPLGPLADTAVTGIAEDVLGAVPDEATLGVVRRAEGVPLLVVEL
LRGLREERAVTVTDGVAVLTGPALPTGFQGSVRRHLDQVSPQAREVVRAAAAVGRTVTVG
LLAELLGTPAAALIEPVQEAVDASLFVEEGERLLFRHDLFREAVEGSLPVAVRKAVRRHA
ADVLLRRGAPVTEVAALLADSAGTGDRVAVELLRQAAAELSASAPSSALALSRRALELTD
GGAAERPVIIAETVLLFWQAGQAAEGRALAAAALPGTMAPEAEAQVRLGLARVSSQYDFT
EAVRQARTGAALAGAAPALRAQLLALECLNLSMAGDFRATADAVAEALDAAADAGDGAAR
ATAVAVDSVVWFYRMDWDRAFALAEDAARLAADVGIAHSLWVPEALWKAFLLNAAARVEE
ALEESASGVRETRRQGQAAAMSLWLSNRCRVLLDAGRLEDARAEAEAAAAMVQDLGLGNF
ADATVLYTLLRVAVHTDDREAVRAYAADVRDRMIADPALLVRNVGSWLLALVADYEGRPD
RAMEVLSEAVGTFGLVGPSLASPDDPADTVVFVRLALRAGATGRAAEAVAAAELRAERNP
RFPVLAAVAAHARGLLDNDLAILLRAVELYEGVPRLLPRASALEDAGRKLASRRAAEAVP
HLDAALNLYTQAGAERDASRVRRRLRAVGAPRRRTSSRRLAAAWPELTASEVAVVRLVAQ
GLTNGRTAEHLGISPHTVSSHLRHAFTKLDITSRVELARLTAEREHAQ
Download sequence
Identical sequences H2JS81
WP_014669380.1.21199 WP_014669380.1.57224 gi|474979122|ref|YP_007689588.1| gi|386836847|ref|YP_006241905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]