SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979164|ref|YP_007689630.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979164|ref|YP_007689630.1|
Domain Number 1 Region: 294-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.06e-28
Family RecA protein-like (ATPase-domain) 0.049
Further Details:      
 
Domain Number 2 Region: 115-287
Classification Level Classification E-value
Superfamily TPR-like 6.32e-27
Family BTAD-like 0.0011
Further Details:      
 
Domain Number 3 Region: 20-93
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000879
Family PhoB-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474979164|ref|YP_007689630.1|
Sequence length 669
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MPVTPRRRIGEEQGPAQAVRFTLLGPVRAWRAGEELPLGPRQQRLLLAALLAGAGRPVPL
TELIGLLWDGDPPVSAVNAVHRYVGSLRRLLEPGLPIRSSGRWLVRQAGSYLLRVDADGL
DLLRFRDLVRRARAATATGDLPAAVDRYLEALDLWQGHCAEDLGAVASVHPAFAMVEHEY
APVVCEAATAALRCGRAGSVLLTVRQAADRCPLDEALQASLLLVLAADGKQAEAIMLYQT
IRARLSDELGVDPGAELRAAHQSVLRGSPAEPRVPASTGSAAPPAAPLPRSRPPWIEPAQ
LPPDLPFFTGRERALDQALDTAHRVGAGLRVLAVDGIPGVGKTALAVHFAHRVAGDFPDG
QLYTDLGGFAAHGDPADPGEVLHGFLEALGVDRHRIPASLEARSALYRSVLSGRRVLVVL
DNALDAEQVRPLLPGTSECMVVVTGRSRLIGLAAAHGARLLSLDLPSVAEATACFLRRVG
PARTDVGVAVVEEIVARCGRLPLALALVAARAASRPEQPLTRLAAELAAAQGSLGGFDEE
DSANAVRGVFSWSYRTLGAEAKRVFRLLPRHRACDIGTAGLASAAGISRDAAATAVGELV
RARLLDIRGRDRYGAHDLVLAYAAELDRAGEADRSAAPRRSYVHSRRSARPVARPVPGRA
DAHLEEWAF
Download sequence
Identical sequences H2JSC3
gi|386836889|ref|YP_006241947.1| gi|474979164|ref|YP_007689630.1| WP_014669422.1.21199 WP_014669422.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]