SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979172|ref|YP_007689638.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979172|ref|YP_007689638.1|
Domain Number 1 Region: 841-897
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000442
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0067
Further Details:      
 
Domain Number 2 Region: 3-65,102-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000118
Family RecA protein-like (ATPase-domain) 0.095
Further Details:      
 
Weak hits

Sequence:  gi|474979172|ref|YP_007689638.1|
Domain Number - Region: 702-817
Classification Level Classification E-value
Superfamily TPR-like 0.00266
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474979172|ref|YP_007689638.1|
Sequence length 909
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSLVGRTSELHALEALLVEAEREGAALLLQGDPGVGKTALLDAATAQARAGGLRVLQVVG
VESEQELAFSALHQLLYPLFDHLAGLPAFQSVVLEQALSIREGSAPGRFAISAAALALLQ
AASKLRPLCVVVDDVHWIDRSSAEVLTFITRRLSSCRAAFVMAARSGAHGFLDPTGLRVI
DVGPLPVPDALVLLDSSHPGLAETTRRRLLDESEGNPLALVELPSQLTDAQRDGVEALPA
NLPLNSRLESVFADRVRRLGSVTRFALLLTALDGERPGNLGDIRAAFGVGSEEWDDGLLE
TGERTGLVRVDHVAEQVTFRHPLVRSCVVHMSPAGRRRAAHRALAEVLKTEPERRALHLA
HAADDPDEAVAVELTRAAERAMARGGAAEAATAYRRAAELSQDPTERVRRLEQAAFAAGI
AGLLGTAHELAGQTTESLRGAAAAGYVQFHREGDIDAVYRILPSAMEAARASTAPTDVDA
FDDAFYVLLNAAVWGGRAELWPPVYRALDQISEPARMCFDCVADPARTAHDVRERLDRAT
AALSPETPLWRVNWLIYTAMYLDCFTYYDGVWREAVGHSAYDSLRFGVVARTHEAFMRGE
WDKVQAIASQGFADATEHEYHLIHIIFTYGLAMVASGRGDEEALRRHCDTITAWAQPRRM
QLLMSTVNETWARAAVGRGDFEEAYLLTSTLTPPGELPSHFPHFSRVFLDLVESAMRTGR
TGAARAHVEAGRKARLDAISPHHELILAAAAAVAAPDEEAGALYEAALAVPDASLWPFDH
ARVRLWYGEWLRRRREYTAARVQLSLALELFEQQLKAPLWAQRARDELRAAGVGVGIADA
RTGVKMSAQERRIAELAASGLSNKEIGRQLNISPRTAGAHLYRVFPKLGITSRAALRDAL
KAFDEAGGT
Download sequence
Identical sequences A0A117QAX0 H2JSD1
WP_014669430.1.21199 WP_014669430.1.28171 WP_014669430.1.57224 gi|386836897|ref|YP_006241955.1| gi|474979172|ref|YP_007689638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]