SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979301|ref|YP_007689767.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979301|ref|YP_007689767.1|
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000323
Family APH phosphotransferases 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474979301|ref|YP_007689767.1|
Sequence length 126
Comment putative trifolitoxin immunity protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MCHNDFSPLNVAFVDGLPVSAFDFDRAAPGPRARDPAHAAWLWLLGAGIACSLDGQSVLL
RTFLDAYGLEEGRRGFGERVGVWGGAERDMRDRAGRVTSPGSWLRLEIDWPKEHADAIDR
YLESRT
Download sequence
Identical sequences H2JV12
gi|474979301|ref|YP_007689767.1| gi|386837026|ref|YP_006242084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]