SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979409|ref|YP_007689875.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979409|ref|YP_007689875.1|
Domain Number 1 Region: 23-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-47
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 2 Region: 866-1175
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.94e-36
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 3 Region: 339-375,442-725
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.06e-31
Family DPP6 N-terminal domain-like 0.032
Further Details:      
 
Domain Number 4 Region: 311-414,765-795
Classification Level Classification E-value
Superfamily TPR-like 0.00000000247
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979409|ref|YP_007689875.1|
Sequence length 1192
Comment protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSQRTWQPGDVVLGLYEVRDVLQGGMGVVHRVRHRGWRIDLAVKTPRPELLGSAEAVRRF
EAEAGTWVELGLHPHTVNCVYVRTVDGLPRVFAEWVDGGSLAEAVSGGRLYAGGPRATLG
RLLDVSVQTAWGLRHAHGSGLVHQDVKPANVLLDPDGTAKVTDFGLAAARSVAEDGPTGP
PGVTYRGMTPAYCSPEQAGAAVGGQGVRLTPATDVWSWALTVLEMFAGRRPTRYGQAAAE
ALEAFLDAGTADPRVPPMPPALAGLLRQCFVGAPGARPALDEAAAVLVSLYGDLMGEPFP
RPAPEASRLLADELSNQALSLLDLGRTEEAEERWQQAVTADPHHLVARYNQGLHLWRRAE
TTDRELLRALEAARDVGGETALAARLLGFVHLERDDRAQAAALLRGAAEEQAEDEPVPDE
LREALTVLAERPQVPTTLLGGHLIAVSAVAFSDDGEWLLSGDSTGSLRLWERAGGRCVRE
LTRAGDMVRAVALSGDASIGLVARYEGLPEVWDLVRGERLPLPPDFPSGEVTAVALNGDG
SFAAIGHADGTVHRWQVPARALVDGFGHHRYGSEALVLSRNNARAYSVGGMREPAVHVWD
LVTRGHAELTVPPDVPDQLRWGPMIKAALAPDGRSAVQIWLGAMVSWDLVTGRITAQAPH
DLVTVSALALAPGGNLAIVDDGATLQVRETATGRVLRTFGEGHDWSRLAASGDGRFVAVG
TLGDGEREGEAAVRVEPLPVLGYRAPWAYARPRPAAELALRAARFAAALEEGRQHVAQGR
YGQAAQCLRRARSVPGFSRHPEVLDTWELLGRHGRRTGLRGVWPTFDFHEPYTLDRPVMA
QFIGDSDTFITPIWTQGLGLLDAARPGPIRVVEGLRGSARAVLTPDFPMAILIGDHGDVA
LYDLDTGSFIPAVQVEDTTAIAVAATSGRLLMGGKDGGVAFLDFVQEAEDQTVSMKGSAL
PALDGEVRAVAISADGRFAASAALADPDPGRAAPRTRTLRGWDLSTESCVWEHVDQARGF
LQFLQFSPDGRTLVHVGGEQVRAFDAATGRALWSLTLENPTAEPVIAVGARRGVVADGTD
MVVFDPTTGRVSTRLRGPARIYSLVLTTDERFAVTGGDEVRVWDLDTGQMVWITPGKSSG
VLALAMSTSGRRLVALGLETFRIWELDWEFAFTPDESDTQQHPPAEGPSSTR
Download sequence
Identical sequences H2JWI0
WP_014669665.1.21199 WP_014669665.1.57224 gi|386837134|ref|YP_006242192.1| gi|474979409|ref|YP_007689875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]