SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979413|ref|YP_007689879.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979413|ref|YP_007689879.1|
Domain Number 1 Region: 43-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-21
Family Extended AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 2 Region: 462-641
Classification Level Classification E-value
Superfamily TPR-like 0.00000000073
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979413|ref|YP_007689879.1|
Sequence length 714
Comment putative regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MQALARALGVDEAGAARLEQSAAAGRPRPRAATGPAGSGTLALPRDIQDFTARGDALARL
AELVPDAGAGLPAVTVVAGQPGLGKTAFAVHAAHRLAPHFPDGQFALDLHGMDAEPTSPR
DALARLLGAIGVADAAIPSGTDDRAGLWRSLAGERRLLLLLDNAAGEFQVEPLLPGTGAS
LTIITSRQALAGLESVHRTDLALLRREETVELLSRIIGPDRVGAEAQAARDLADLCGHLP
LAVRIAGQRLLSRPHERLGKLVARLATEARRLDALQAGSLRVRAAFALSYRQLPPRSQTL
LRRAALAAGADFSPETGALLAGLTCDEAAACAEELTDAGLLQSDPAGERYRFHDLLRLYA
AEQIDAEDGPEVRDAALDRTALWMLRRATAAALHFDVDHEQTASRSDPDPDTAPIGREEA
RAWLEAERAEWLAALRRAHDTGRHRQVLDAAQAMHWFSDLNQHWEQWVEVFRQSADSARA
LGSRQEEAVHLNYLAWAYNLCVHDPRAALTAADSALAAARECGDGLQQGWALGYGAGALH
RLGRTEEAQERLRDSARCLASQESPHGRLAELTILNSLGTLLRQTGRAAEALEIHRRSER
ICRAGIPGRTVEVVGLYHAVARQQIGNDLAALERWHEAEAPLRQALAAFDAAQMPAWSEQ
ARLDLGRVLGATGHPEARATLLAARDALVALRDPRQVEAAEALAALDANGACTG
Download sequence
Identical sequences H2JWI4
gi|474979413|ref|YP_007689879.1| gi|386837138|ref|YP_006242196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]