SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979551|ref|YP_007690017.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979551|ref|YP_007690017.1|
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-63
Family ABC transporter ATPase domain-like 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474979551|ref|YP_007690017.1|
Sequence length 227
Comment ABC transport system ATP-binding protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSLTLTGITLTYPDGDTRLTALDQVSLKVPQGSLTAVVGPSGSGKSSLLAVAATLITPDT
GTVTIDGQSTIGLTPGALTKLRRHKIGIVFQQPNLLPSLTAAEQLQVMAQIDGRKPRTAH
ARAMELLDAVGLAAQAGRRPHQLSGGQRQRVNIARALMNDPAVLLVDEPTSALDQERGAA
VIDLITRLTHQQATATVLVTHDRAHLTAVDQIAEVHDGRLVLSAVAT
Download sequence
Identical sequences H2JZM5
gi|474979551|ref|YP_007690017.1| gi|386837274|ref|YP_006242332.1| WP_014669805.1.21199 WP_014669805.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]