SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979599|ref|YP_007690065.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979599|ref|YP_007690065.1|
Domain Number 1 Region: 828-893
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.11e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 
Domain Number 2 Region: 352-435,543-649
Classification Level Classification E-value
Superfamily TPR-like 0.0000000142
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Weak hits

Sequence:  gi|474979599|ref|YP_007690065.1|
Domain Number - Region: 8-220
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000443
Family RecA protein-like (ATPase-domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474979599|ref|YP_007690065.1|
Sequence length 898
Comment LuxR-family regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MIVERLDGLCSAGPAGSALIIEGDAGIGKSSLLDLAVQHGAASGVRVLRCTGLQAASPLG
YTGLHELLHPLMPLVDDLPPRQRAALLTAFALDEGATPDRLLVGLSALGLLEEAARNQPL
LVAVEDLQWLDHSSVHVLNFIGLRVSAAPITLLATLRSDGDADALPPLPIERLRLGPLAE
NAARALLDDVAADLRPASRGRILSESSGNPLALHELPTALRQHGIERTTLHAHLPITKRL
ERAFLDQLQPLPAASRSLLVLAAASDGAQLQDIMAAARRLGLGVEALSPLEERGLVSVGD
SGLRFRHPLLRSAVHSAARTSEWVEAHLALAAVTAGQDRAVWHRAAAALEWDETVAGELE
GVAARAHDRGAQPEAMSAYRRAATLTQDARERARRLALAAEAARSAGMTAEALELLEQVG
PLSPASGAETITQVALIRTILSLTAAAPAPSSNDFEEILGLLPVPEENERRVIVLWGASV
LTRGRNLPSADWDYLRGNLEATRTSSPLKPAALAILAPGGQAAAMRDRLPSLIPQLAEFP
LGMLSLAIAAESLQDLQTSLTCWELSRERSHNQGAPADELQALRGKANVLLLRGQLREGL
AAAEYSERMAADTQQQMIGSFAVATAARAHALLGDLDAATAAIRRSRELSRMAPLAMISA
DLRWAAGLIASQRGRHRDALIEFTHVAVHSTRALWTIADRTEAAVRAGRADQVRDNVDAA
DEAARAYQSAYLAALVARSRALLAGDDEAAGEEFEKSVAAGAVEESRLEVARSRLLYGQW
LRRRRSQAAAREQLALALTEFDAIGARGYADRAAGELRAAGETPHRAPGHSWAHEKLTAQ
ELQVARLAAKGMSNKEIADSIYLSHRTVSSHLYRVYPKLGITSRAQLAAALQDSGDDL
Download sequence
Identical sequences H2K148
gi|386837322|ref|YP_006242380.1| gi|474979599|ref|YP_007690065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]