SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979722|ref|YP_007690188.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979722|ref|YP_007690188.1|
Domain Number 1 Region: 748-804
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.74e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|474979722|ref|YP_007690188.1|
Domain Number - Region: 2-38,77-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000169
Family G proteins 0.087
Further Details:      
 
Domain Number - Region: 481-595
Classification Level Classification E-value
Superfamily TPR-like 0.074
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979722|ref|YP_007690188.1|
Sequence length 821
Comment hypothetical protein SHJGH_1188 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MFLGGRPGIGKSALLDEVARTHATAFRLLRVTGHSDEAALPFAAAERLIAPIRGSVEGLP
GPQRTALRVVLGLEEGSADPFFVRMAVTGALQAAARKTPLMVLVDDFHLLDRESAAIVSF
LSRRIGGVPLCLVCAGAGAGGRAGRVDGERMTLGPLSESESLALVEWLVPSSTAETRNRF
VEASGGIPLLLRGASRVLTSVRLPGHGLRPDGPAAPAGAAPGHRGTVEPPAGMAPCRAST
VEPPAEPVAASVSAPVACRVHIRPDPGGARQSLPVVVRRAIVGAALPDRLLGLGASAEHR
PPRGTAALEAVEHAFAQGRTERLAELLDEARTVRETGLMNRYARLQGLVTLVTRSPVAAV
GELLAAARMTGADDPAFAVDTLNMAVSAAWLAGDPAVLEEAHSARAKLVEAAGTRPLPER
TGDPVALRVLAGPPDAVDRTGATDRPEDPAAAGSRTAATAPPPGCPLPPGDPERHRAFYT
ELLRRALKDGEWGSVPVAAYWAACLETWLGRWNQARDHIRQGLSSAERTGQVILTGYLRS
LNAWLHAVVGEVAACRAEAEACLKDAAVHVTDSVRLAAQGALAFAALSEGRPEEAPRLLP
SSPTGVAGTALGGRGSLAVFDMIEAAYRTFETPRARQMLDLWRRSGPQARACGTEALVLR
CEALLEEDPDRMERMFHQVLAVAHPNEFERARTRLLFGERLRRARRTRFAREELLAAVET
FGLVGAPLWADRAQRELDACAIRSSSAKEGWHALTAQERQVLQLAGQGLTNRQIAQALFI
SPRTVGYHLYKAYPKLDIQSRRQIRDVVPGDGHEVPGPADG
Download sequence
Identical sequences gi|474979722|ref|YP_007690188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]