SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980030|ref|YP_007690496.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980030|ref|YP_007690496.1|
Domain Number 1 Region: 20-196
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-19
Family Prokaryotic proteases 0.07
Further Details:      
 
Weak hits

Sequence:  gi|474980030|ref|YP_007690496.1|
Domain Number - Region: 294-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000213
Family Atu3015-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474980030|ref|YP_007690496.1|
Sequence length 1362
Comment hypothetical protein SHJGH_1496 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTGGPPASRAAVEPSRVARVAVYDPRRENYALGTGYRISHRLVLTAAHVVEGDGHILVDL
DGDGEWPRAERVWQDREVDVALLRFESAPATTVTPVHLGRVDGTVADRVSADALGYPVHA
LVVDDLTGHQYRGRQHVRCRIVTAARGRPKTLRLELDSTPDPHASGDSPWRGMSGAAVVT
RDSGLLVGVFREHVPAMGVSAHDATDLAAIDDRRWCELLREEGVRPEPRPAPPDGWDTTG
GHLALHHQHLADLAGNETVFTRHALPFVDPAPEHPATPAHILAKLGELAGDALAPLGVVL
TGPAGTGKSRICLETARLADQQDWLVVHLDDDVPLDAAWSCVHPLARRILLVVDDIVSLT
ELSRRVADRLCWAADNKGVELAVLVAARTTAWRRLRLEPFFHRVEVPADPAYHAGVRRAA
VRALAGPAVRQIGERRTMRLCGGPPAMALHLAHLRGLQAARGQDLRRAVPLHARSVTVWM
GDVLDEEGLAGPGVRSAAGLWDEEPPPSRLLMDSARAVAATPCTFDELAGVLGRDTAQQC
ATELRLRGVLEERGREVRMTHGLFADQLLARALLRADEATVRHESLGAVLDTGLAHPRLF
GNVLRAINQLHDALGETRDELLPEAVGQWFGEADGARTLRAGELIAADPQGRALLTLLRG
RPGQHLAQRFPQQIVEPWLRANYLHSEARHALVAVRSHLDASRSLAYLMGWIDKNAVLPE
AAYVFHHAVPAADAHPAFSEWTVDSMYEYLTRNWDRIEASRVYDRLLDTAKGLALPEGDP
RAPQVVGWALVWLRHHPGRPEAGYFAPQLVLRPELTGRRLAATAQYLLDTVVPRDPGHAS
YSLEPLLKRHRLRRDLPHPVFKRTVKDALAWLEDENLGLLAEAAYVLGELLRRELPGRDD
APRAAQCALRWLETRATHPDAWRVLTPLLTKVRKPPARAEAMLTPDECAELADHAVAWLR
EPGAEPRNKVSLLGALLRTRLLDDDEVLPHLARQALALFRESPVPTTARSLLPPLLAKDS
LPVQDKDAVFEAAFDYLRHHPRSEHTSYPLTVLVSRHGLTEQRFRDVMTATLDWIDAHPR
QTSAFRLLAGALSSPSAGAAERSRLAGRVIEMLSAELLATEAQHHLTKRLLKHRDEIVPE
WNRFVARACQLLAAAGFPPSGLTVLSPMLKGADRLDQPTRDALCATCAAWCEVRPLSSTA
LTLLRTVLTSRPLFPYARRTLSAAGCRMISPDTARKQEGGGLLLELLRQGDLAAVPAADA
DGGSPIEKVVRVSLDWLDAWPEDDRANALLHQVTYRLRHRAGTPARPRPGTAQGRDEPTA
AQATERAIHHWETWLAAHPDATQPERATAEEHLRHLRGMVRG
Download sequence
Identical sequences H2JLG4
gi|474980030|ref|YP_007690496.1| gi|386837821|ref|YP_006242879.1| WP_014670346.1.21199 WP_014670346.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]