SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980186|ref|YP_007690652.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980186|ref|YP_007690652.1|
Domain Number 1 Region: 13-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-49
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 429-728
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.15e-37
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number 3 Region: 881-1162
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.08e-36
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 4 Region: 314-429
Classification Level Classification E-value
Superfamily TPR-like 0.000000401
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474980186|ref|YP_007690652.1|
Sequence length 1167
Comment protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MALGTWRPGEVVLDLYEVLDDVRSGGMGVVHRVRHRGWNVDLAVKTPRPELVASETGRRR
FEAEAGTWVSLGLHPHTVNCAYVRTVDGLPRVFAEWVDGGSLAEAITGGSLYEGGPRAAL
ARVLDVAVQTAWGLQHAHDTGLVHQDVKPANVMLEPDGTAKVTDFGLAGARPADTGGTGA
APSAVTFGGMTPAYCSPEQALAAAGRREIRLTPATDVWSWALTVLEMFTGRRPTRYGQAA
AAVLEALLDAGPADPRVPPMPPAVVGLLRQCFRTEATARPARLDEVADVLRDAYGDLTGT
PFPRRAPQAAALLADGLSNQALSLLDLGRTEEAEARWREAMTAEPHHLVATFNFGLHRWR
TAQKTDLDLIAELESAREISGDDVLGARLIGLVHLERDDRERAAELLRPAAPGEPDPAET
VAALAELTRHPGTRPVVLAGHEAGVSAVAVSADGGLVLSGDHRGGLRLWETAGGRCLREL
TSEGPAVVVTALDAEGRIGLVGREQGPPEAWDLAHGERLPLPQGPVAAGVTAVALSADGS
VGATGHADGTLLFRHLRTGRILGPVQSQVELMTVLELSDDGAVALTAGDLRDDKVRLWDV
ATGVCRAVLTEPRANPLHSAWGGFVRRAAAAPGARYAVQVWGGPMVLWDVRTGRIATQAP
HHLTDVTALALTPDGSLAVVGSGNPLQVVQTATGRCLRTLDEGTARHVHHLAVSADGRYA
VLRTTDGVRIRVQPLPVPGYRAPWAYARPRPAGELSDHAGRFRAAMREGERLLDEGRYAR
SAAWLRTARAVPGHARHPDLRHAWNALGRHGRRTGLLGAWQTFDFTGRVAHPSALAFVGD
TSLFLAALHGDRFLLCDAANARQYRVIASTATADVALVVTRDGTRAVVHGMGEAALLDLR
DDRTVMLPHDAVRAVAWADDSGWLLTGDDSGHLCRWDIEDVARRHDHAKPSLAFRAHQGQ
VESVAISPDGRYGASNAFAGAEEDRQRRHDQDELCGWDLASGQRLWRRTGRPGRAGLRFT
PDGRTLLEYGLSSVHSYDAASGRRICAVDGPYSVRTLVTSADGRRAVIAGYGTLVVLDPA
TGRVLREIRDPGLINVLTLTSDGRFALVGLAHQEVHVWDLDEGRRLRVLSGHQGQVFGLA
LSADARHLLAAGVDSVRCWELDWDYDW
Download sequence
Identical sequences H2JPM4
gi|386837977|ref|YP_006243035.1| WP_014670502.1.21199 WP_014670502.1.57224 gi|474980186|ref|YP_007690652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]