SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980205|ref|YP_007690671.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980205|ref|YP_007690671.1|
Domain Number 1 Region: 757-821
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000156
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|474980205|ref|YP_007690671.1|
Domain Number - Region: 30-146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000699
Family RNA helicase 0.048
Further Details:      
 
Domain Number - Region: 557-658,700-728
Classification Level Classification E-value
Superfamily TPR-like 0.0122
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number - Region: 355-389,430-574
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0357
Family Bacterial glucoamylase C-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474980205|ref|YP_007690671.1|
Sequence length 836
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MHSSPDVRRPTDPAHQPVGAPAGHDTAAETLLRLAGGDRPLVIAVDDAHAMDRASLQTIV
HLLHRGRSRRVLVVCATSGHLGETRSPAHTELLRQPHRRVRLAPLSEASVGELLAAQAGR
ALPGHIRDAYHRATAGSPLLVHALLDDSTHSAPEIGLPVAGAAYRQAVLSLLHRGAPGHV
RVARALAALGSLAGTVPVGELAGTTPAGTQEAVDVLNSSGLLDGHAFRHPTAAAAVLEDM
DAVARTRLHGRIAHLLYRSGAPAVEVARHLRLADLVPAGWGAGILRTAAEQALAADDVER
CTDYLGLVLRDCADERERHALSVALARAQWRTNPAAATPHLEPLREAALAGELSMRDAAT
VLRYLLWQGDTELAAQAVATLVHAQSPADAQIVAEVEFVRQWFYGVALPGKGAPVAGLDP
RRRQAHAGTGGLAARVAALIGGEATDDSAAAVAQALQGHQLDHLNLELAAMSLLAVAHAD
RPAIAADACDALLERAVERRATTWQALLGSIRAEIALLQGDVTTASQGALTALGTLRAES
WGVLIGLPLSTAISAHTALDSYDEAEELLKHDVPEPMFRTVFGIQYLRARGHHFLATDRP
FAALGDFETCGRLLREGNPSLQKGIPWRSDLALANLRIGKARTAREWAEEQLRLPGGHSS
RARAMALRLLAATCKPHRRASLLRESIDLLKACGDRYALAQAYADLSAAHYELGEYARAR
LVARQAAREAEACRIESPVDAHLLEDPVRPDSADSDAGPAILSDAECRVAGLAALGYTNR
EISARLHVTISTVEQHLTRVYRKLNVANRSELPSKMLDHRIPKLSDRWAGTHSSAG
Download sequence
Identical sequences H2JPP3
gi|474980205|ref|YP_007690671.1| gi|386837996|ref|YP_006243054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]