SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980244|ref|YP_007690710.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980244|ref|YP_007690710.1|
Domain Number 1 Region: 115-282
Classification Level Classification E-value
Superfamily TPR-like 1.52e-26
Family BTAD-like 0.00036
Further Details:      
 
Domain Number 2 Region: 287-312,339-551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-19
Family Extended AAA-ATPase domain 0.051
Further Details:      
 
Domain Number 3 Region: 18-111
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000454
Family PhoB-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474980244|ref|YP_007690710.1|
Sequence length 570
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MVRVPGGLGDVARSEVLRFEVLGPLRVLRAGSELDLGYPQARALLGVLLVWPGRPVRMST
IVDVLWPGRPPADAPNAVRRHVGTLRRLLEPGLPPRAPGRRLLGRTGGYLLEAAAHEADL
PRFRAFTRRGMRAAATARPEQAVRHFAGALRLWRGPVAAGLPGPVRAHPHFAAVDREILR
TARMAADAALLCGRADQVLPSVRRAVALNPLDEPLLARLILSLAACGLQAEALATYEDAR
RDLAAQLGVAPGAELAAAHARVLRRQIRPARHRLPAAPPDPARPFVRPAQLPPDLPVFTG
RNRELTALDALLDGETAGAPQTAPDALRGAEAVPDAPAPSTGVCPASGVLISGPAGVGKT
ALAVHWAHRVADRFPDGQLHLELGGSAPHQAALEPAEALRRLLGALGVSTRSMPEGVAAL
AARYRGVLTGRRLLVLLDDAACLAQLRPLLPEAPGCLTVVTSRGGPIGPRPVAEPAGPAG
RLGLSGSRERAAGALRTLYLGLPCEADARDLLARRIGAARPAAEPEAVREIVRRCGRLPS
ALALVAARAASRRDFPLAALAADLAEDAEP
Download sequence
Identical sequences A0A124HN60
WP_015493180.1.21199 WP_015493180.1.28171 WP_015493180.1.57224 gi|474980244|ref|YP_007690710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]