SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980438|ref|YP_007690904.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980438|ref|YP_007690904.1|
Domain Number 1 Region: 200-370
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.66e-33
Family Prokaryotic proteases 0.0000252
Further Details:      
 
Domain Number 2 Region: 396-438
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000262
Family Carbohydrate binding domain 0.00057
Further Details:      
 
Weak hits

Sequence:  gi|474980438|ref|YP_007690904.1|
Domain Number - Region: 39-96
Classification Level Classification E-value
Superfamily Alpha-lytic protease prodomain 0.000549
Family Alpha-lytic protease prodomain 0.0035
Further Details:      
 
Domain Number - Region: 124-184
Classification Level Classification E-value
Superfamily Alpha-lytic protease prodomain 0.0204
Family Alpha-lytic protease prodomain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474980438|ref|YP_007690904.1|
Sequence length 439
Comment serine protease precursor [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MAAGALLVAGLSGSASARPSSLPAAPTAAETLRTDAAPPALLRALQRDLGLNRQQAERRL
GNEAEAGAASGRLRAALGAHYAGAWVRGAESDTLTVATTDPADVPAIRAQGAAARVVDHS
LAALDAAKARLDRVAARRATTDTPVWYVDVPTNALVVRAVRTDAARSLLAAAGVDASLVR
VVKSAEQPRPLYDLRGGDAYYIDNSSRCSIGFPVTRGTQQGFATAGHCGRAGSATTGSNR
VAQGTFQASVFPGNDMAWVAANAGWTATPYVNGSSAQVTGSTQATVGSSVCRSGSTTGWH
CGTVQQLNSSVTYQEGTVTGVTRTSVCAEPGDSGGSFVSGSQAQGVTSGGTGNCTSGGTT
YFQPVNPILQSYGLTLKTTATGPGDPGDPGDPGGTWSAGTVYQAGATVTYGGAVYRCLQT
HQAQQGWEPPNTPALWQRQ
Download sequence
Identical sequences H2JTU9
WP_014670754.1.21199 WP_014670754.1.57224 gi|474980438|ref|YP_007690904.1| gi|386838229|ref|YP_006243287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]