SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980664|ref|YP_007691130.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980664|ref|YP_007691130.1|
Domain Number 1 Region: 89-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-30
Family Extended AAA-ATPase domain 0.036
Further Details:      
 
Domain Number 2 Region: 626-744
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000341
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 3 Region: 6-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000153
Family SinR domain-like 0.085
Further Details:      
 
Domain Number 4 Region: 555-654
Classification Level Classification E-value
Superfamily TPR-like 0.00000000464
Family CT2138-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474980664|ref|YP_007691130.1|
Sequence length 774
Comment putative regulatory protein AfsR-like protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSGQEVAFGPLLRSMRRAKSLTIEALAEVSGVSERGIGDLERGRRAAPQRRTVAALADGL
GLDDADRERLLAAARAGRTPGYSPVGVRSFPRGIDDFAGRADELAELEALAAPPRQDRAA
GEGGGVPEGQPVVVVIHGPPGTGKTTLALRAARRLADRFPDGQLMVDLRGTDDSPPAPSE
LMVRVLKAFGVPDRDLAKAGPQAHPALYRQVLADRRCLLVLDNARDEAQVRPLLPGSGGT
LVLVTSRRVLTGLDDVHRLPLGRLEPAESAAFLASLVGEARATAEPEALEEVARLCEHLP
LALRIAGNWLATRTGWTVRRLADRLASEERRLDALSAGDVRVATAFDLSYRQLTPTAARL
FRRLSLVPGPDLGAVCAARLTGQDVHDAEDTLEELVEAGLLGSAEDRYRLHDLLCLYGRG
RLVAEDDEADIERARRSMFRWLLDTAVVAGRWYEPGHGAPPASWRGTVDLSSADKAREWL
QTESANWLAALHAAAAEGDHATVVEVAESLHWFSDQWIFWGHWPEVFGAAVRSAEALGDP
LLEATQLNYHAWAVMLCEGRPRDSIPYTARALDAARRAGDAGQQGWAHAYASWAHRALGE
DGPAAEHSDHAIALFEAAGDLHGLLQALISRAAHLRGVGRDEEAIETYRQVLTRLDEAGD
RLEPHIAAFTRVNALAGVGGCYGSLGRWEEAVEYLRTSVELSRTDGNIALESRYLLSLGD
ILLQAGRPAEAREAFTRCVALGSDADPRRVAEARSRLARLDGDRHRPPPGVGVR
Download sequence
Identical sequences H2JY69
gi|474980664|ref|YP_007691130.1| WP_014670980.1.21199 WP_014670980.1.57224 gi|386838455|ref|YP_006243513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]