SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980678|ref|YP_007691144.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980678|ref|YP_007691144.1|
Domain Number 1 Region: 40-140
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000285
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474980678|ref|YP_007691144.1|
Sequence length 143
Comment hypothetical protein SHJGH_2144 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTDNFTGYTAGDGVAPDRWASALHLFDDGAGAPHEETTTERWERAQLLFEAKDYIGAARL
LALVVEEAPEQTGPRLLLARAYYHSAQLRRAEEQLRAIIERDPVEHYAHLMLGRTLQRQG
RQDEAEPLLRMAAAWSGEFPEDD
Download sequence
Identical sequences A0A0S2NUS8 A0A124HLL8 H2JY83
gi|386838469|ref|YP_006243527.1| gi|474980678|ref|YP_007691144.1| WP_014670994.1.21199 WP_014670994.1.28171 WP_014670994.1.57224 WP_014670994.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]