SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474980721|ref|YP_007691187.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474980721|ref|YP_007691187.1|
Domain Number 1 Region: 375-540
Classification Level Classification E-value
Superfamily TPR-like 0.0000119
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474980721|ref|YP_007691187.1|
Sequence length 1307
Comment hypothetical protein SHJGH_2187 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDHTRGLSSGERVLGLLMGLRKGTLDGRDLGLRAYERLRAWEEDPDDVQALQDATVMYAE
ALRSIPRKHPSRLGLIEQLAACHLCLWIAGGHPDNVRQSLELMAEALRLTPPGAVQDWAE
RRWYTMLIHVLRYGATKYAGDLRHADGFRGELAPFLTGPFRHPWEPDVRAAVCLADAQLA
AVQGDAAACAGLVDRARQVLGGAVPPTGGRLVETWGVLIRRRTRSLAIAYEDTDDEQALA
EALALASCGIDAFGAVPGTPAMLLRFRGCLRAARYQFHRRRDDALLARDDFDASLSLTEP
FHTEARAETQWRLARLFVLMSDHRQLDAADAARVHTLTTQSLAALPPGSVEHAQCLVAAA
DIRREAAPDGSTELLHEAVGLYRQALPVLRDTNTGWEVHNRLSIALGALYKARGDLGHLD
AAIEHADRALALCPARAAPLNAPLLHSTLGEFLRVRYERLARHEDYDRALDHTRHGLELS
RYPGGAPQWALRVSNHALVVALGGGAENLQKSEDLLHEALGHANLEPWERTHLHLNLGAT
MREAAEATQDRKRLRTAILHLERAEASVAEGQALPLIRRNLALALHTQWRLEHRAASLDK
AHDLIEAALEDTPAGSPLRALLLSDLGALLVARAHRRLGPDDAIPSPGGSEAEERAREDV
ERAVEVLRAARAEPGAGLAELGLFATQYGEALSFLGRLTGDPGLLEASLRALREAVRSLD
EQGPHWVLPALFLADALVGEERTSNEHRHEAAELYGKVARHPMAAPATRWRAAVARARIL
TQAADWAGALDAYSTGIATLPQMAWGGLDFDDRLNVLSNTSQTVSDAAAVALEAGAPERA
LELLEHGRGLLLSSALDMRTDLEAIRLRAPELAADLALSRDERASGGVRASDDVGIRRRQ
SQRRWDRLVDMVRQEPGLADFLEPLPYQELLGTSSHGPVVVLNSSPLRADALVLHDGRLT
VVPLARFRHNKAVLRADALTRSVHRPGNGDAEERLARRPYLTDVLDWLWTTVAEPVLRVL
PPALARDTNSAPPRIWWCPTGVFNRLPVHAATRLPDPCEPDQGGTDSLADRFVASHTPTL
RALKAARAEAARTASRTTSPVLLVGVGKTPPYTEHPPLDHVALEIDAVAGLLPAARTLRD
EEAVRDVVVRHLRTGGWLHFAGHGEQDTASPDGVLYLWDHYPSGSLRIQDIARLHLEQAE
LAYLSACETHRTPTAHSDEPVSLAGALQLAGYRHVVASQWQLNSLRASQVARAFYTTLLL
TPDGHPRLPGPEAAARSAHALHTAVGILRARRPDAVDMWAAYVHIGP
Download sequence
Identical sequences H2JYC6
gi|474980721|ref|YP_007691187.1| gi|386838512|ref|YP_006243570.1| WP_014671037.1.21199 WP_014671037.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]