SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474981168|ref|YP_007691634.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981168|ref|YP_007691634.1|
Domain Number 1 Region: 344-588
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-32
Family Extended AAA-ATPase domain 0.0087
Further Details:      
 
Domain Number 2 Region: 13-47,159-254
Classification Level Classification E-value
Superfamily TPR-like 0.0000000211
Family CT2138-like 0.075
Further Details:      
 
Weak hits

Sequence:  gi|474981168|ref|YP_007691634.1|
Domain Number - Region: 268-292
Classification Level Classification E-value
Superfamily beta-Roll 0.0955
Family Serralysin-like metalloprotease, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474981168|ref|YP_007691634.1|
Sequence length 624
Comment ATPase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MMDFGTQGPEAPADLAWLRGVDAYTMGAYPQAEEEFRTAVRMDPGMADAWLGLHALRVDT
TTALLRMFRHRDRFGEQRARHRRSLNSWYWLGWWVQPVLESSRDLLLAHASHWLDGRHVP
ELDRALAGLPPVDADPQVRFLHACRAYLVKDWEQLARHTDPLLDDSLLGIEAGLFGGMAR
VRLEMYGQAEPLLSTALMRCRSEQPQRKELRYWLARAHEGTGRSAAALPLYRAVHRVDPA
FMDTSARLAAISEGDGYDETADYAAITLTGAGQDVVDGPDGFDPLFGTEGRDLRLPEPDL
PAGPLPSVADPSVRTKTGVAGVSTAPIPAGPTDPALLEEALAELERMVGLEPVKRQVKAL
SAQLNMARLRAGQGLPVQPPKRHFVFSGPSGTGKTTVARILGRVFYALGLLGGDHLVEAQ
RADLVGEYLGQTAVKANELIDSAIGGVLFVDEAYSLSNSGYGKGDAYGDEALQVLLKRAE
DNRDHLVVILAGYPEGMDRLLAANPGLSSRFTTRVDFPSYRPLELTEIGKVLAAENGDLW
DEEALDELRSIAGHVVDQGWIDELGNGRFLRTLYEKSCAYRDLRLSTYAGSLTRNDLATL
RLPDLMQAYGEVLSGRGPQDPPGM
Download sequence
Identical sequences gi|474981168|ref|YP_007691634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]