SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474981486|ref|YP_007691952.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981486|ref|YP_007691952.1|
Domain Number 1 Region: 122-293
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-39
Family Prokaryotic proteases 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474981486|ref|YP_007691952.1|
Sequence length 300
Comment fibrinolytic protease precursor [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRIKRTTPRGGTARRVQLTAVAAGFLAAAAFAAPTANASDVHTFSATQLTKASDSVRQAD
VPGTAWAVDSKTGRVVVTVDSTVSQAEIAKIKKQAGANADALVVKHTPGKFNKLISGGDA
IYASSWRCSLGFNVQDSSGNYYFLTAGHCTDGAGTWWSNSSHTTTLGTTAGSSFPGNDYG
IVRYTNSSVTKSGAVGSQDITSAATPSVGTTVYRRGSTTGTHSGRVTALNATVNYGGGDI
VSGLIQTTVCAEPGDSGGPLYGGTTAYGLTSGGSGDCTSGGTTFFQPVTEALSAYGVHVY
Download sequence
Identical sequences A0A0S2NWN6 A0A124HJX3 H2JPX1
gi|474981486|ref|YP_007691952.1| WP_014671796.1.21199 WP_014671796.1.28171 WP_014671796.1.57224 WP_014671796.1.88765 gi|386839277|ref|YP_006244335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]