SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474981596|ref|YP_007692062.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981596|ref|YP_007692062.1|
Domain Number 1 Region: 24-153
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000628
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474981596|ref|YP_007692062.1|
Sequence length 225
Comment hypothetical protein SHJGH_3062 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MGRLAVALLLAVVTLGLLGAARQLRPVPYGDRLLTAGPHAGAWAARVRDGAVTGHDSRTG
ALRWRYARAGHRPVDVVHARGEVIALWDDGLLTDTDGRSVRWHRALPDAAEWLPAQGGTG
VLRPLGRGILAVVTPRRVTAYRTADGDLRWVLPARNGCAFRPEGAVRRGAALLLAQPCTD
AAWTGQLVALDDLGRIAPDRTPLGNGSPAAAPRTPGGGKPLAPPR
Download sequence
Identical sequences A0A101Q974 H2JRF9
gi|474981596|ref|YP_007692062.1| gi|386839386|ref|YP_006244444.1| WP_014671904.1.21199 WP_014671904.1.28171 WP_014671904.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]