SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474981762|ref|YP_007692228.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474981762|ref|YP_007692228.1|
Domain Number 1 Region: 12-118
Classification Level Classification E-value
Superfamily TPR-like 2.52e-18
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474981762|ref|YP_007692228.1|
Sequence length 126
Comment hypothetical protein SHJGH_3229 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MPETSGSTGRTPETHVIDFRAAEQLLNARDPRGAVKLLDGVIAAHPENTAARLLRARAFF
AAAQLRPAELEFTIVLEREPDNAYAHFALARTYERQGRPDQAKRHFRLAAALDPNPQYLK
AARFEE
Download sequence
Identical sequences A0A0S2NY65 A0A101Q9J4 H2JU71
gi|386839552|ref|YP_006244610.1| gi|474981762|ref|YP_007692228.1| WP_014672069.1.21199 WP_014672069.1.28171 WP_014672069.1.57224 WP_014672069.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]