SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982224|ref|YP_007692690.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982224|ref|YP_007692690.1|
Domain Number 1 Region: 3-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-60
Family Protein kinases, catalytic subunit 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474982224|ref|YP_007692690.1|
Sequence length 424
Comment hypothetical protein SHJGH_3691 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MERIGGYLVERRLGEGGMGTVYLARTRGGRAVALKVAKAELAADPVFRERFRSEVEAARA
VGGFHTAPVVDADVDGDPLWLATAYIPGPTLAARLAAEGAMDEPGLRSLGAALAEALESI
HACGLVHRDLKPGNIIMAVDGPRVLDFGIARAAESTRLTATGTAFGTPGFLAPEQALGHD
VTGAADVFALGAVLVAAAGGSAWGEGTPMGLMYRSVHEPPDLSAVPAGLADLVSACLAKE
PADRPTPAALLDRLTDPAPDPARPTAPPYPPTLTASPVPATPPPAFTPPPPPATPPQAAA
PLYQHPVQTATPPHLPAQPATPPAPYGFGPPLPYGTPEVVLADAQSGAVVNATGVLFEVA
GVTADFPWAEIAHVVRHWRGNRLTLTVRLWDGGVYSCELNARRRARLTAWLAQLDPVLAR
YLTR
Download sequence
Identical sequences H2K3H7
gi|474982224|ref|YP_007692690.1| WP_014672530.1.21199 WP_014672530.1.57224 gi|386840013|ref|YP_006245071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]