SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982230|ref|YP_007692695.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982230|ref|YP_007692695.1|
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.65e-42
Family PhyH-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474982230|ref|YP_007692695.1|
Sequence length 187
Comment SnoK-like protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MWPSALHPPLRELPLHHKALAVARELIGADAELDFDMMIHKDPHTAVPTPWHQDAAYWID
MPDHRAVSIWVALDDADVDNGCMWYVRGSHEQPLRPHRPTSDGKNIECDCSEDEPGATAV
PLRAGEAVAHSGFTLHYSRGNTTDGTRRAYILNYRPAAMIRHERAQGADHGLNENVRQVR
NSGAAED
Download sequence
Identical sequences A0A117QK32 H2K3I2
gi|386840018|ref|YP_006245076.1| gi|474982230|ref|YP_007692695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]