SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982652|ref|YP_007693118.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982652|ref|YP_007693118.1|
Domain Number 1 Region: 125-234
Classification Level Classification E-value
Superfamily TPR-like 0.00000168
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 2 Region: 205-322
Classification Level Classification E-value
Superfamily TPR-like 0.0000843
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474982652|ref|YP_007693118.1|
Sequence length 362
Comment putative transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MWEVTALSAPWTEGGTVETLTDLVGSGRTDRRGFLTITGAALTGLAASWVEAPSAFAAAL
DGDRVTHTMVSTVEQRIATLRALDDQLGGARLLEQARGDLALVTGLLGAGRYTDGIRVRL
YALAARVSHLTGWMAYDAGLRSAGQRYYVGALRSARTAGDDAFGAFVLAEMGVHVSEAGR
TAERVGLISTALDNAPRDLSPCTRSFLYLHKAEALSRNGDHREAGTALNRAASIWDRQSA
DETPDWLDWFGEAQLKSTEGKVLLRSGQVERATRSLEISVGRAAPRDRAVRSSRLAEARL
AGGDLDGALFAANHGARLLEEEVSSVRALDRLKEFSARLEPHKSVAAVREFRERLQALCG
SV
Download sequence
Identical sequences H2JNG2
gi|474982652|ref|YP_007693118.1| WP_014672958.1.21199 WP_014672958.1.57224 gi|386840443|ref|YP_006245501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]