SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982700|ref|YP_007693166.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982700|ref|YP_007693166.1|
Domain Number 1 Region: 87-338
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000417
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 318-464
Classification Level Classification E-value
Superfamily TPR-like 0.00000000337
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474982700|ref|YP_007693166.1|
Sequence length 482
Comment secreted protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MGTSLVPEPPAPRRRVLRRVLVASLAGGVVAGTVLMLLPHERRHGPAAPPAAGPEARPRA
QVPVLTTVTYGVPAALPGLTALIGRQERLVRAQPRDARAWAVLGSAYVERGRRAGDAADY
PKAERALRESLKVRGGRNTEALDGLAALALARRDFPAAKGYGEQALKAAPKRWQAYPPLI
DAYTGLGDYEKARSTLDKLLALRTDAAARPAVMARASAVYRDRGWREDAVAQLTDAAAAA
RTPAEQAAWLAGLGQLAWERGDLADALRHFEAALRLDPDQRPAATGRARTLAALGHTPQA
LAAYRAVVAKQPNPADLLELGELYESLGQPGVAEEQYTRMKEAVRRAVSGGVDEEVLIGR
YEADHGDPWDGVERLREEWRRQPGIEVADALGWALHRAGEDEEALTFATTATDKAKGGGV
RSALYAYHRGVIEAELERYAPARRHLEEALRINPYFSPLKAPLAREALRELGDVPDEPPP
SE
Download sequence
Identical sequences H2JNK9
WP_014673005.1.21199 WP_014673005.1.57224 gi|474982700|ref|YP_007693166.1| gi|386840490|ref|YP_006245548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]