SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983174|ref|YP_007693640.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474983174|ref|YP_007693640.1|
Domain Number - Region: 32-83
Classification Level Classification E-value
Superfamily TPR-like 0.0948
Family BTAD-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474983174|ref|YP_007693640.1|
Sequence length 89
Comment hypothetical protein SHJGH_4643 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSRGRRPASPSGPAVAYKGVPSIDLGEGLFVNAPTVRSALLRLARAHSRNGRTAEAGLLL
GMRQRLIDDPGAELGEDLKLVLRKGFGAV
Download sequence
Identical sequences H2JX53
gi|386840963|ref|YP_006246021.1| WP_014673472.1.21199 WP_014673472.1.57224 gi|474983174|ref|YP_007693640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]